BioFusion Peptides LL-37 5MG research vial on a clean light background, featuring a white label with the BioFusion Peptides logo and standardized design, positioned beside a matching product information card

LL-37 (5MG)

$94.99

LL-37 is an antimicrobial peptide fragment widely referenced in scientific literature for its relevance in studies involving innate immune signaling, host-defense pathways, and cellular response mechanisms. Researchers frequently evaluate this peptide in models focused on membrane interaction, inflammatory signaling modulation, and pathogen-recognition biochemical processes. Each vial is supplied as a lyophilized peptide and undergoes third-party analytical verification to confirm identity and purity for laboratory research use.

Categories: ,

LL-37 Research Solution

LL-37 is a human-derived antimicrobial peptide fragment frequently referenced in scientific literature for its relevance in studies involving innate immune signaling, host-defense pathways, and cellular response mechanisms. Researchers commonly explore LL-37 within models examining peptide–membrane interaction, inflammatory signaling regulation, and molecular processes associated with pathogen recognition.

In published research contexts, LL-37 is often discussed in investigations focused on its role in modulating chemotactic activity, influencing toll-like receptor pathways, and participating in barrier-function–related biochemical cascades. Because of its involvement in these scientific frameworks, LL-37 is widely utilized in laboratory environments studying immunomodulatory pathways, peptide structure–function relationships, and host–microbe interaction dynamics.

This research material is supplied as a lyophilized peptide and undergoes third-party analytical verification to confirm identity and purity prior to distribution.

Specifications

  • Peptide: LL-37 (Cathelicidin Antimicrobial Peptide Fragment)

  • Sequence: [LL-37, 37 aa]

  • Form: Lyophilized Peptide (5 mg)

  • Purity: ≥ 98% (HPLC Verified)

  • Molecular Weight: 4493.3 g/mol

  • Storage: Store in a cool, dry environment away from direct light

  • Intended Use: Laboratory research and analytical reference only

Related products